PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1156_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 397aa    MW: 44502.8 Da    PI: 9.6797
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1156_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.2e-15453148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                                         r+rW +eEd ll  +vkq+G + W++I+ +mg  + R +k+c +rw +yl
  cra_locus_1156_iso_1_len_1663_ver_3  4 RQRWQPEEDALLRAYVKQYGAKEWNLISTRMGktLDRDPKSCLERWKNYL 53
                                         89**********************************************97 PP

2Myb_DNA-binding35.81.9e-1159103147
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +g+ T+eE+ l + + +++G++ Wk+Ia++++ gRt+k +  +w  +
  cra_locus_1156_iso_1_len_1663_ver_3  59 KGSLTPEEQNLVISLQAKYGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                                          6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.253157IPR017930Myb domain
SMARTSM007172.6E-13355IPR001005SANT/Myb domain
SuperFamilySSF466892.62E-22498IPR009057Homeodomain-like
CDDcd001671.74E-9653No hitNo description
Gene3DG3DSA:1.10.10.604.0E-21660IPR009057Homeodomain-like
PfamPF139215.5E-15768No hitNo description
PROSITE profilePS5129418.50758108IPR017930Myb domain
SMARTSM007174.1E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-1661108IPR009057Homeodomain-like
CDDcd001675.01E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MKERQRWQPE EDALLRAYVK QYGAKEWNLI STRMGKTLDR DPKSCLERWK NYLKPGIKKG  60
SLTPEEQNLV ISLQAKYGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQLKQ LQKSQNRQEY  120
SSDPAAVSAV SGGGSPDKAA QGKYDHILET FAEKYVQPKL FGFHHQSSSL PLPPTIMPNI  180
SIPDPPPVVL SLGSVAIPEP VAISAGLPAW MNTTPTTTSS LTSSSSTTPS PSVSLSLSPS  240
EPAVLDPDLG LGGGRYFPVQ QMSSLVQYCK EVEEGRQNWV QHKKEAAWRL SRLEQQLESE  300
KARKRREKME EIEGKIRCLR EEEMGFLCKI ESEYRDQLSA LQRDAEAKEG KLMEAWCSKH  360
VKLAKLVEQI GGVLHHGSSS SSHGGFITTS LPKDHLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-147921092B-MYB
3zqc_A3e-1411100995MYB3
3zqc_D3e-1411100995MYB3
3zqc_G3e-1411100995MYB3
3zqc_J3e-1411100995MYB3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1302307RKRREK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009630091.10.0PREDICTED: protein rough sheath 2 homolog
SwissprotO809311e-105AS1_ARATH; Transcription factor AS1
TrEMBLA0A068U2N00.0A0A068U2N0_COFCA; Uncharacterized protein
STRINGVIT_14s0083g00120.t011e-173(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29332445